ChemBuyGuide's Logo ChemBuyGuide Chemical Procurement Guide
  • Home
  • Contact Us

MedBio脉铂医药

  1. CN
  2. http://www.med-bio.cn/
Company Info
  • About Us
  • Certification
  • Contact Us
Catalogue
  • Products
  • Quotation

Products

Product Name Product No. CAS No.
PA 452 2811027 457657-34-0 Inquiry
Pazopanib 2811461 444731-52-6 Inquiry
NU6140 2812403 444723-13-1 Inquiry
GlyT2-IN-1 2813716 448947-81-7 Inquiry
NS1643 2813812 448895-37-2 Inquiry
6-Amino-N-hydroxy-3-pyridinecarboximidamide 2814184 468068-28-2 Inquiry
Lu AE 58054 Hydrochloride 2814273 467458-02-2 Inquiry
17-DMAG 2815004 467214-21-7 Inquiry
ITE 2815102 448906-42-1 Inquiry
4-(Cycloheptylamino)-N-[[(2R)-tetrahydro-2-furanyl]methyl]-thieno[2,3-d]pyrimidine-6-methanamine 2816320 446257-23-4 Inquiry
GW788388 2816779 452342-67-5 Inquiry
piperidin-1-yl(1-m-tolyl-1H-indazol-6-yl)methanone 2817396 451496-96-1 Inquiry
PAMAPIMOD 2818079 449811-01-2 Inquiry
(OC-6-44)-Tricarbonylchloro(glycinato)ruthenium 2819854 475473-26-8 Inquiry
AC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2 2820202 475221-20-6 Inquiry
Cytostatin (sodium salt) 2820343 457070-06-3 Inquiry
MJN228 2821806 459168-97-9 Inquiry
2-butylsulfinyl-4-phenyl-6-thiophen-2-ylthieno[5,4-b]pyridin-3-amine 2822118 459147-39-8 Inquiry
Insulin-like Growth Factor-1 Receptor Inhibitor 2824043 468740-43-4 Inquiry
Lersivirine(UK 453061) 2824974 473921-12-9 Inquiry
  • ‹
  • 1
  • 2
  • ...
  • 135
  • 136
  • 137
  • 138
  • 139
  • 140
  • 141
  • ...
  • 238
  • 239
  • ›

Company

  • About

Site Index

  • Product CAS Index
  • Product Name Index
  • Partner Name Index

Resources

  • Help
  • Your Account
  • Paypal
  • Privacy & Policy
  • Terms
  • Site Map

© 2026 ChemBuyGuide. All rights reserved.

Log in

Don't have an account yet? Sign up

Log in with Email

Log in

Don't have an account yet? Sign up

Please enter a valid email address.
Forgot Password?
Please enter a valid password.

Sign up

Already have an account? Log in

Sign up with Email

By continuing you agree to our Terms and Conditions

Sign up

Already have an account? Log in

Please enter a valid email address.
Your password is invalid. Please try again.
Password does not match the confirm password.

By continuing you agree to our Terms and Conditions

Forgot password?

Enter the email address you used when you joined and we'll send you instructions to reset your password.

Back to Log in
Please enter a valid email address.
Trusted by the world's best teams
Logo
Logo
Logo
Logo
Quick Links
  • Search Results List
  • Search Results Grid
  • About
  • Services
  • Invoice
  • Profile
  • User Contacts
  • Reviews
  • Settings
Image Description
Featured Item

Create astonishing websites and pages.

Apply now
SVG

Your cart is currently empty

Before proceed to checkout you must add some products to your shopping cart. You will find a lot of interesting products on our "Shop" page.

Start shopping